Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

346 – 360 of 1,444,027 results

346

Invitrogen™ HVCN1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q3U2S8, Q96D96
Isotype	IgG
Concentration	1 mg/mL
Antigen	HVCN1
Gene Symbols	HVCN1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	0610039P13Rik; AI450555; BTS; HV1; Hvcn1; hydrogen voltage gated channel 1; hydrogen voltage-gated channel 1; mVSOP; RGD1310788; UNQ578/PRO1140; Voltage sensor domain-only protein; voltage-gated hydrogen channel 1; Vsop; Vsop.
Gene	HVCN1
Product Type	Antibody
Gene ID (Entrez)	304485, 74096, 84329
Formulation	PBS with 0.02% sodium azide
Immunogen	A 17 amino acid peptide near the carboxy terminus of human HVCN1.
Classification	Polyclonal
Primary or Secondary	Primary

347

Invitrogen™ STEAP2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q8BWB6, Q8NFT2
Isotype	IgG
Concentration	1 mg/mL
Antigen	STEAP2
Gene Symbols	STEAP2
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	4921538B17Rik; AI930049; AW045895; IPCA1; IPCA-1; Metalloreductase STEAP2; PCANAP1; prostate cancer associated protein 1; prostate cancer-associated protein 1; protein upregulated in metastatic prostate cancer; Protein up-regulated in metastatic prostate cancer; PUMPCn; six transmembrane epithelial antigen of prostate 2; six transmembrane epithelial antigen of the prostate 2; six-transmembrane epithelial antigen of prostate 2; SixTransMembrane protein of prostate 1; STAMP1; STEAP family member 2, metalloreductase; Steap2; STEAP2 metalloreductase; STMP; UNQ6507/PRO23203
Gene	STEAP2
Product Type	Antibody
Gene ID (Entrez)	261729, 74051
Formulation	PBS with 0.02% sodium azide
Immunogen	A 16 amino acid peptide from near the carboxy terminus of human STEAP2.
Classification	Polyclonal
Primary or Secondary	Primary

348

Invitrogen™ Klotho Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Maintain refrigerated at 2-8°C for up to 3 months. For long term storage store at -20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunohistochemistry (PFA fixed),Western Blot
Form	Liquid
Gene Accession No.	O35082, Q9UEF7, Q9Z2Y9
Isotype	IgG
Concentration	1 mg/mL
Antigen	Klotho
Gene Symbols	KL
Regulatory Status	RUO
Purification Method	Antigen Affinity Chromatography
Gene Alias	alpha-kl; HFTC3; Kl; Klotho; Klotho peptide; secreted form of Klotho protein
Gene	KL
Product Type	Antibody
Gene ID (Entrez)	16591, 83504, 9365
Formulation	PBS with 0.02% sodium azide
Immunogen	A 17 amino acid peptide near the center of human KLOTHO.
Classification	Polyclonal
Primary or Secondary	Primary

349

Invitrogen™ Citrate Synthase Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Monkey,Chicken
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O75390, P23007, Q8VHF5, Q9CZU6
Isotype	IgG
Concentration	1.02 mg/mL
Antigen	Citrate Synthase
Gene Symbols	CS
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	2610511A05Rik; 9030605P22Rik; Ahl4; BB234005; Cis; citrate (Si)-synthase; citrate synthase; citrate synthase precursor (EC 4.1.3.7); citrate synthase, mitochondrial; citrate synthetase; Cs; wu:fb58e04; zgc:55507
Gene	CS
Product Type	Antibody
Gene ID (Entrez)	100309916, 100309917, 100309924, 100309934, 100310091, 100310549, 100310550, 100310552, 100310659, 100327409, 100327410, 100858903, 12974, 1431, 170587
Formulation	PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the center region of human Citrate synthetase. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

350

Invitrogen™ Norepinephrine Transporter Monoclonal Antibody (CL3063)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin)
Form	Liquid
Gene Accession No.	O55192, P23975
Isotype	IgG1
Concentration	1.0 mg/mL
Antigen	Norepinephrine Transporter
Gene Symbols	SLC6A2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	NaCl-dependent norepinephrine transporter; NAT1; NE transporter; NET; NE-T; NET1; neurotransmitter transporter; neurotransmitter transporter, noradrenal; NORADR; noradrenaline; noradrenaline transporter; norepinephrine transporter; Slc6a2; SLC6A5; sodium-dependent noradrenaline transporter; solute carrier family 6 (neurotransmitter transporter), member 2; solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2; solute carrier family 6 member 2; solute carrier family 6 member 5; transmembrane region 4..26 transmembrane region 55..77 transmembrane region 105..123 transmembrane region 136..157
Gene	SLC6A2
Product Type	Antibody
Gene ID (Entrez)	20538, 6530, 83511
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein fragment of Human SLC6A2 (Product #RP-102393)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CL3063

351

Invitrogen™ CD4 Monoclonal Antibody (74-12-4), PE-Cyanine5

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Pig
Host Species	Mouse
Conjugate	PE-Cyanine5
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	0
Isotype	IgG2b κ
Concentration	0.1 mg/mL
Antigen	CD4
Gene Symbols	CD4
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	Activation B7-1 antigen; B7; B7.1; B7-1; BB1; B-lymphocyte activation antigen B7; CD28LG; CD28LG1; CD4; CD4 antigen; CD4 antigen (p55); CD4 antigen p55; Cd4 molecule; CD4 precursor; CD4 receptor; CD4, allele 1; cd4a; CD4mut; CD80; CD80 antigen (CD28 antigen ligand 1, B7-1 antigen); CD80 molecule; cell surface glycoprotein CD4; costimulatory factor CD80; costimulatory molecule variant IgV-CD80; CTLA-4 counter-receptor B7.1; fCD4; L3T4; LAB7; Leu-3; Ly-4; lymphocyte antigen CD4; lymphocyte antigen CD4 precursor; membrane protein; p55; T-cell differentiation antigen L3T4; T-cell surface antigen T4/Leu-3; T-cell surface glycoprotein CD4; T-cell surface glycoprotein CD4 precursor (T-cell surface antigen T4/Leu-3) (T-cell differentiation antigen L3T4); T-lymphocyte activation antigen CD80; W3/25; W3/25 antigen
Gene	CD4
Product Type	Antibody
Gene ID (Entrez)	404704
Formulation	PBS with proprietary stabilizer and <0.1% sodium azide; pH 7.1
Immunogen	Fresh dd miniature swine thymocytes.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	74-12-4

352

Phospho-SHP-1 (Tyr536) Recombinant Rabbit Monoclonal Antibody (Shp1Y536-2A7), PE, Invitrogen™

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Rabbit
Conjugate	PE
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG κ
Gene Accession No.	P29350
Antigen	Phospho-SHP-1 (Tyr536)
Gene Symbols	PTPN6
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	70Z-SHP; EC 3.1.3.48; hcp; Hcph; hematopoietic cell phosphatase; hematopoietic cell protein-tyrosine phosphatase; HPTP1C; me; motheaten; protein tyrosine phosphatase, non-receptor type 6; protein-tyrosine phosphatase 1C; Protein-tyrosine phosphatase SHP-1; PTN6; Ptp1C; PTP-1C; Ptph6; PTPN6; PTPTY-42; SH2 phosphatase 1; SHP1; Shp-1; SHP-1L; SH-PTP1; Tyrosine-protein phosphatase non-receptor type 6
Gene	PTPN6
Product Type	Antibody
Gene ID (Entrez)	5777
Formulation	PBS with 0.20% BSA and 0.09% sodium azide
Immunogen	A synthetic phospho-peptide corresponding to residues surrounding Tyr536 of human phospho Shp1.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	Shp1Y536-2A7

353

Invitrogen™ AMHR2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Lyophilized
Gene Accession No.	Q16671, Q62893, Q8K592
Isotype	IgG
Concentration	500 μg/mL
Antigen	AMHR2
Gene Symbols	AMHR2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AMH type II receptor; AMHR; Amhr2; Anti-Muellerian hormone type II receptor; anti-Muellerian hormone type-2 receptor; anti-Mullerian hormone receptor type 11 SV1; anti-Mullerian hormone receptor type 2; anti-Mullerian hormone receptor type II; anti-Mullerian hormone receptor, type II; anti-Mullerian hormone type 2 receptor; anti-Mullerian hormone type 2 receptor delta 2; anti-Mullerian hormone type 2 receptor delta 9/10; C14; MIS type II receptor; Misiir; MISR2; MISRII; MRII; Muellerian inhibiting substance type II receptor; Mullerian inhibiting substance type II receptor
Gene	AMHR2
Product Type	Antibody
Gene ID (Entrez)	110542, 269, 29530
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE).
Classification	Polyclonal
Primary or Secondary	Primary

354

Invitrogen™ Rovalpituzumab Recombinant Monoclonal Antibody

Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Human
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry,Functional Assay,Surface Plasmon Resonance
Form	Lyophilized
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	Rovalpituzumab Humanized
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Rovalpituzumab tesirine; Rova-T
Product Type	Antibody
Formulation	25mM histidine with 0.01% Tween 80, 8% sucrose and no preservative; pH 6.2
Classification	Recombinant Monoclonal
Primary or Secondary	Primary

355

Invitrogen™ Complement C3b Monoclonal Antibody (10C7)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA,Flow Cytometry
Form	Liquid
Gene Accession No.	P01024, P01027
Isotype	IgG1
Concentration	1 mg/mL
Antigen	Complement C3b
Gene Symbols	C3
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	Acylation stimulating protein; acylation-stimulating protein cleavage product; AHUS5; AI255234; ARMD9; ASP; C3; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1; C3a; C3a anaphylatoxin; C3adesArg; C3b; C3bc; C3-beta-c; Complement C3; Complement C3 alpha chain; Complement C3 beta chain; Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3c alpha' chain fragment 2; Complement C3d fragment; Complement C3dg fragment; Complement C3f fragment; Complement C3g fragment; complement component 3; complement component C3a; complement component C3b; CPAMD1; ENCF-1; ENCF-2; epididymis secretory sperm binding protein Li 62p; HEL-S-62p; HSE-MSF; iC3b; Neutrophil chemotactic factor-1; Neutrophil chemotactic factor-2; Plp; prepro-C3
Gene	C3
Product Type	Antibody
Gene ID (Entrez)	12266, 718
Formulation	PBS with 0.02% sodium azide
Immunogen	C57BL/6 thymocytes incubated with a rat IgG2b anti-murine Thy-1 (RmT1) and C57BL/6 serum (as a source for C3).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	10C7

356

Invitrogen™ B-Raf (V600E) Recombinant Rabbit Monoclonal Antibody (RM8)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ELISA,Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P15056
Isotype	IgG
Concentration	1 mg/mL
Antigen	B-Raf (V600E)
Gene Symbols	BRAF
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	94 kDa B-raf protein; 9930012E13Rik; AA120551; AA387315; AA473386; Braf; B-raf; B-raf protein; B-raf protein isoform 1; B-raf protein isoform 2; B-Raf proto-oncogene serine/threonine-protein kinase; B-Raf proto-oncogene serine/threonine-protein kinase (p94); B-Raf proto-oncogene, serine/threonine kinase; Braf transforming gene; BRAF1; B-RAF1; Braf2; Braf-2; C230098H17; C87398; C-RMIL; D6Ertd631e; FLJ95109; MGC126806; murine sarcoma viral (v-raf) oncogene homolog B1; NS7; p94; Proto-oncogene B-Raf; proto-oncogene c-Rmil; RAFB1; RMIL; rmil serine/threonine-protein kinase; serine/threonine kinase; serine/threonine-protein kinase B-raf; Serine/threonine-protein kinase Rmil; v-raf murine sarcoma viral oncogene homolog B; v-raf murine sarcoma viral oncogene homolog B1
Gene	BRAF
Product Type	Antibody
Gene ID (Entrez)	673
Formulation	PBS with 50% glycerol, 1% BSA and 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to B-Raf V600E mutant.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	RM8

357

Invitrogen™ Ki-67 Polyclonal Antibody

Chicken Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human,Mouse,Rat
Host Species	Chicken
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	E9PVX6, P46013
Isotype	IgY
Concentration	Conc. Not Determined
Antigen	Ki-67
Gene Symbols	Mki67
Regulatory Status	RUO
Gene Alias	antigen identified by monoclonal antibody Ki 67; antigen identified by monoclonal antibody Ki-67; Antigen identified by monoclonal antibody Ki-67 homolog; Antigen KI-67; Antigen KI-67 homolog; antigen KI-67; proliferation marker protein Ki-67; antigen KI-67-like; cb31; D630048A14Rik; I79_022666; Ki67; Ki-67; KIA; LOW QUALITY PROTEIN: proliferation marker protein Ki-67; marker of proliferation Ki-67; MIB-; MIB-1; Mki67; PPP1R105; Proliferation marker protein Ki-67; proliferation-related Ki-67 antigen; protein phosphatase 1, regulatory subunit 105; RP11-380J17.2; sb:cb31; si:ch211-250b22.7; unnamed protein product; wu:fa11g09; wu:fb57a07; wu:fi14e05
Gene	Mki67
Product Type	Antibody
Gene ID (Entrez)	17345, 291234, 4288
Formulation	PBS with 0.02% sodium azide
Immunogen	Mixture of recombinant human Ki67 constructs expressing the N-terminal region, amino acids 1-300 and an internal region, amino acids 1111-1490.
Classification	Polyclonal
Primary or Secondary	Primary

358

Invitrogen™ CaMKII alpha Polyclonal Antibody

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human,Mouse,Rat
Host Species	Goat
Conjugate	Unconjugated
Applications	Flow Cytometry,Western Blot,Immunocytochemistry,Western Blot
Form	Liquid
Gene Accession No.	P11275, P11798, Q9UQM7
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	CaMKII alpha
Gene Symbols	CAMK2A
Regulatory Status	RUO
Purification Method	Ammonium sulfate precipitation
Gene Alias	alpha CaM kinase II; alpha-CaMKII; Ca2+/calmodulin-dependent protein kinase II; Ca2+/calmodulin-dependent protein kinase II alpha; Calci; calcium/calmodulin dependent protein kinase II alpha; calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha; calcium/calmodulin-dependent protein kinase II alpha; calcium/calmodulin-dependent protein kinase II alpha subunit; calcium/calmodulin-dependent protein kinase II alpha-B subunit; calcium/calmodulin-dependent protein kinase type II alpha chain; calcium/calmodulin-dependent protein kinase type II subunit alpha; CaM kinase II alpha subunit; caM kinase II subunit alpha; CaMK II; CAMK2; Camk2a; CAMKA; CaMKII; CaMK-II alpha subunit; caMK-II subunit alpha; CaMKIINalpha; CaM-kinase II alpha chain; EC 2.7.11.17; KIAA0968; mKIAA0968; OTTHUMP00000165787; OTTHUMP00000165788; Phospho-CaMKI; PK2CDD; PKCCD; R74975
Gene	CAMK2A
Product Type	Antibody
Gene ID (Entrez)	12322, 25400, 815
Formulation	TBS with 0.5% BSA and 0.02% sodium azide; pH 7.3
Immunogen	Synthetic peptide sequence (PRTAQSEETRVWHR) corresponding to the internal amino acids of CAMK2A (aa 444-457).
Classification	Polyclonal
Primary or Secondary	Primary

359

Invitrogen™ NF-H Polyclonal Antibody

Goat Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat,Bovine,Pig,Horse
Host Species	Goat
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunohistochemistry (PFA fixed),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P12036, P12037, P16884, P19246
Isotype	IgG
Concentration	1 mg/mL
Antigen	NF-H
Gene Symbols	Nefh
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	200 kDa neurofilament protein; CMT2CC; heavy neurofilament protein; I79_012512; intermediate filament protein; KIAA0845; LOW QUALITY PROTEIN: neurofilament heavy polypeptide; mKIAA0845; NEF3; Nefh; nefh.L; neurofilament; neurofilament 200kDa; neurofilament heavy; neurofilament heavy L homeolog; neurofilament heavy polypeptide; neurofilament heavy polypeptide-like; neurofilament triplet H protein; neurofilament, heavy polypeptide; neurofilament, heavy polypeptide 200kDa; neurofilament, heavy polypeptide L homeolog; neurofilament-H; NF 200 kD; NF200; Nfh; NF-H; NHC; XELAEV_18007418mg
Gene	Nefh
Product Type	Antibody
Gene ID (Entrez)	100064328, 100156492, 24587, 380684, 4744, 528842
Formulation	PBS with 50% glycerol and 5mM sodium azide
Immunogen	Native NF-H purified from bovine spinal cord.
Classification	Polyclonal
Primary or Secondary	Primary

360

Invitrogen™ RPA70 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P27694, Q8VEE4
Isotype	IgG
Concentration	0.4 mg/mL
Antigen	RPA70
Gene Symbols	RPA1
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	5031405K23Rik; 70kDa; AA589576; AW557552; Cb1-727; HSSB; MST075; MSTP075; REPA1; Replication factor A protein 1; replication protein A 70 kDa DNA-binding subunit; Replication protein A 70 kDa DNA-binding subunit, N-terminally processed; replication protein A1; replication protein A1, 70kDa; RF-A; RF-A protein 1; Rpa; RP-A; RP-A p70; RPA1; RPA70; Single-stranded DNA-binding protein
Gene	RPA1
Product Type	Antibody
Gene ID (Entrez)	6117, 68275
Formulation	PBS with 1% BSA, 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen	Recombinant protein encompassing a sequence within the C-terminus region of human RPA70. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

Prev
1
...
22
23
24
25
...
96,269
Next

Welcome to fishersci.com

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ HVCN1 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ STEAP2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Klotho Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Citrate Synthase Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Norepinephrine Transporter Monoclonal Antibody (CL3063) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD4 Monoclonal Antibody (74-12-4), PE-Cyanine5 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Phospho-SHP-1 (Tyr536) Recombinant Rabbit Monoclonal Antibody (Shp1Y536-2A7), PE, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ AMHR2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Rovalpituzumab Recombinant Monoclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Complement C3b Monoclonal Antibody (10C7) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ B-Raf (V600E) Recombinant Rabbit Monoclonal Antibody (RM8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Ki-67 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CaMKII alpha Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ NF-H Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ RPA70 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HVCN1 Polyclonal Antibody

Invitrogen™ STEAP2 Polyclonal Antibody

Invitrogen™ Klotho Polyclonal Antibody

Invitrogen™ Citrate Synthase Polyclonal Antibody

Invitrogen™ Norepinephrine Transporter Monoclonal Antibody (CL3063)

Invitrogen™ CD4 Monoclonal Antibody (74-12-4), PE-Cyanine5

Phospho-SHP-1 (Tyr536) Recombinant Rabbit Monoclonal Antibody (Shp1Y536-2A7), PE, Invitrogen™

Invitrogen™ AMHR2 Polyclonal Antibody

Invitrogen™ Rovalpituzumab Recombinant Monoclonal Antibody

Invitrogen™ Complement C3b Monoclonal Antibody (10C7)

Invitrogen™ B-Raf (V600E) Recombinant Rabbit Monoclonal Antibody (RM8)

Invitrogen™ Ki-67 Polyclonal Antibody

Invitrogen™ CaMKII alpha Polyclonal Antibody

Invitrogen™ NF-H Polyclonal Antibody

Invitrogen™ RPA70 Polyclonal Antibody